anti-human TLR5
$345.00
Amount: 200 ug
Synonyms: Toll/interleukin-1 receptor-like protein 3 (TIL3)
Specifications
Host Species: Goat
Antigen: Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5
Reactive Species: Human
Format/Conjugates/Purification: Affinity Purified
Buffer & Formulation: Affinity purified antibody @1mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: Polyclonal
Applications
ELISA: 1:37,500
Western Blotting: 1:50
IHC: 1:250
Flow Cytometry: 1:200
References
Crellin NK, Garcia RV, Hadisfar O, Allan SE, Steiner TS, Levings MK. Human CD4+T cells express TLR5 and its ligand flagellin enhances the suppressivecapacity and expression of FOXP3 in CD4+CD25+ T regulatory cells. JImmunol. 2005 Dec 15;175(12):8051-9. Full Text FC
Maase C, Heidemann J, von Eiff C, Lugering A, Spahn TW, Binion DG, DomschkeW, Lugering N, Kucharzik T. Human intestinal microvascular endothelialcells express Toll-like receptor 5: a binding partner for bacterialflagellin. J Immunol. 2004 Apr 15;172(8):5056-62. Full Text WB





