anti-human TLR10
$345.00
Amount: 200 ug
Synonyms: Toll Like Receptor 10, CD290
Specifications
Host Species: Goat
Antigen: 31 amino acid (aa) synthetic peptide C-HNRIQQLDLKTFEFNKELRYLDLSNNRLKSV corresponding to aa 81-111 of the N-terminal domain of Human TLR10
Reactive Species: Mouse not tested
Format/Conjugates/Purification: Affinity Purified
Buffer & Formulation: Affinity purified antibody @ 1mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: Polyclonal
Applications
Western Blotting: 1:500
IHC: 1:125
References
Bourke E, Bosisio D, Golay J, Polentarutti N, Mantovani A. The toll-like receptor repertoire of human B lymphocytes: inducible and selective expression of TLR9 and TLR10 in normal and transformed cells. Blood. 2003 Aug 1;102(3):956-63. Full Text
Chuang T, Ulevitch RJ Identification of hTLR10: a novel human Toll-like receptor preferentially expressed in immune cells. Biochim Biophys Acta. 2001 Mar 19;1518(1-2):157-61. Abstract
