Specifications
Host Species: Goat
Antigen: Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to 35-65 residues of N-terminus of human IL-21 receptor.
Reactive Species: Human, Mouse not tested
Format/Conjugates/Purification: Affinity Purified
Buffer & Formulation: Affinity purified antibody @ 1mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: Polyclonal
Applications
ELISA: 1:50,000
IHC: 1:150
References
Ozaki K, Kikly K, Michalovich D, Young PR, Leonard WJ. Cloning of a type 1 cytokine receptor most related to the IL-2 receptor beta chain. Proc Natl Acad Sci U S A. 2000 Oct 10;97(21):11439-44 Full Text





