Specifications
Host Species: Goat
Antigen: Synthetic peptide 78CFQKAQLKSANTGNNERIINVSIKKLKRKPPS109 corresponding to N-terminus region of human IL-21
Reactive Species: Human
Format/Conjugates/Purification: Affinity Purification
Buffer & Formulation: Affinity purified antibody @ 1 mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: Polyclonal
Applications
ELISA: 1:50,000
IHC: 1:250
References
Parrish-Novak J et al. Interleukin 21 and its receptor are involved in NK cell expansion and regulation of lymphocyte function. Nature 2000, 408 (6808), 57-63 Abstract
