Specifications
Host Species: Goat
Antigen: Synthetic peptide CRHLIDIVEQLKIYENDLDPELLSAPQDVK corresponding to N-terminus of mouse IL-21
Reactive Species: Mouse, Human not tested
Format/Conjugates/Purification: Affinity Purified
Buffer & Formulation: Affinity purified antibody @ 1mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: Polyclonal
Applications
ELISA: 1:100,000
IHC: 1:500
References
Liu R, Van Kaer L, La Cava A, Price M, Campagnolo DI, Collins M, Young DA, Vollmer TL, Shi FD. Autoreactive T cells mediate NK cell degeneration in autoimmune disease. J Immunol. 2006 May 1;176(9):5247-54. Abstract
