
anti-human TRAIL-R3
$345.00
Amount: 200 ug
Synonyms: tumor necrosis factor receptor superfamily member 10C precursor, Decoy receptor (DcR1), Decoy TRAIL receptor without death domain, TNF-related apoptosis-inducing ligand receptor 3, TRAIL receptor 3, Trail receptor without an intracellular domain, Lymphocyte inhibitor of TRAIL, Antagonist decoy receptor for TRAIL/Apo-2L, and CD263 antigen
Specifications
Host Species: Goat
Antigen: Synthetic peptide EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC aa 33-63, corresponding to the extracellular domain sequence of human TRAIL-R3 (DcR1)
Reactive Species: Human, Mouse, Chimpanzee
Format/Conjugates/Purification: Affinity Purification
Buffer & Formulation: Affinity purified antibody @ 1mg/ml in 10 mM KHPO4, 140 mM NaCl with BSA @ 1mg/ml and 0.1 % sodium azide
Storage: Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: Polyclonal
Applications
ELISA: 1:25,000
Western Blotting: 1:150
IHC: 1:25
Flow Cytometry: 2ul/10^6 cells/100ul
References
Sanlioglu AD, Korcum AF, Pestereli E, Erdogan G, Karaveli S, Savas B, Griffith TS, Sanlioglu S. TRAIL death receptor-4 expression positively correlates with the tumor grade in breast cancer patients with invasive ductal carcinoma. Int J Radiat Oncol Biol Phys. 2007 Nov 1;69(3):716-23. Abstract IH
Aydin C, Sanlioglu AD, Karacay B, Ozbilim G, Dertsiz L, Ozbudak O, Akdis CA, Sanlioglu S. Decoy receptor-2 small interfering RNA (siRNA) strategy employing three different siRNA constructs in combination defeats adenovirus-transferred tumor necrosis factor-related apoptosis-inducing ligand resistance in lung cancer cells. Hum Gene Ther. 2007 Jan;18(1):39-50 Abstract IH
Secchiero P, Corallini F, di Iasio MG, Gonelli A, Barbarotto E, Zauli G. TRAIL counteracts the proadhesive activity of inflammatory cytokines in endothelial cells by down-modulating CCL8 and CXCL10 chemokine expression and release. Blood. 2005 May 1;105(9):3413-9. Full Text FC
Spierings DC, de Vries EG, Vellenga E, van den Heuvel FA, Koornstra JJ, Wesseling J, Hollema H, de Jong S. Tissue distribution of the death ligand TRAIL and its receptors. J Histochem Cytochem. 2004 Jun;52(6):821-31. Full TextWB, IH
Basile JR, Zacny V, Munger K. The cytokines tumor necrosis factor-alpha (TNF-alpha ) and TNF-related apoptosis-inducing ligand differentially modulate proliferation and apoptotic pathways in human keratinocytes expressing the human papillomavirus-16 E7 oncoprotein. J Biol Chem. 2001 Jun 22;276(25):22522-8. Full Text WB


