Toll-Like Receptors (TLRs)
anti-human TLR8
$345.00
Amount: 200 ug
Synonyms: Toll Like Receptor 8, CD288
Specifications
Host Species: Goat
Antigen: 30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8
Reactive Species: Human, Mouse
Format/Conjugates/Purification: Affinity Purified
Buffer & Formulation: Affinity purified antibody @ 1mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: Polyclonal
Applications
Western Blotting: 1:500
IHC: 1:125
References
Chuang TH, Ulevitch RJ. Cloning and characterization of a sub-family of human toll-like receptors: hTLR7, hTLR8 and hTLR9. Eur Cytokine Netw. 2000 Sep;11(3):372-8. Abstract






