anti-human IL-22R-alpha-2
$345.00
Amount: 200 ug
Synonyms: Interleukin 22 Receptor Alpha 2
Specifications
Host Species: Goat
Antigen: Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein
Reactive Species: Human, Mouse, Rat
Format/Conjugates/Purification: Affinity Purified
Buffer & Formulation: Affinity purified antibody @ 1mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: Polyclonal
Applications
ELISA: 1:50,000
IHC: 1:150
References
Literature Reference: Xu W, Presnell SR, Parrish-Novak J, Kindsvogel W, Jaspers S, Chen Z, Dillon SR, Gao Z, Gilbert T, Madden K, Schlutsmeyer S, Yao L, Whitmore TE, Chandrasekher Y, Grant FJ, Maurer M, Jelinek L, Storey H, Brender T, Hammond A, Topouzis S, Clegg CH, Foster DC. A soluble class II cytokine receptor, IL-22RA2, is a naturally occurring IL-22 antagonist. Proc Natl Acad Sci U S A. 2001 Aug 14;98(17):9511-6. Full Text
