Toll-Like Receptors (TLRs)
anti-human TLR4
$325.00
Amount: 200 ug
Synonyms: Toll Like Receptor 4, CD284
Specifications
Host Species: Goat
Antigen: Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to aa 161-192 of the N-terminal domain of Human TLR4
Reactive Species: Human, Mouse
Format/Conjugates/Purification: Affinity Purified
Buffer & Formulation: 1 mg/ml 10 mM KHPO4, 140 mM NaCl with 1 mg/mL BSA and 0.1 % sodium azide
Storage: Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: Polyclonal
Applications
Western Blotting: 1:500
IHC: 1:125
References
Beutler B. TLR4 as the mammalian endotoxin sensor. Curr Top Microbiol Immunol. 2002;270:109-20. Abstract
